Tricellulin antibody (Middle Region)

Catalog No. ABIN634907

Product Details anti-Tricellulin Antibody

Target: Tricellulin (MARVELD2)

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tricellulin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MARVELD2 antibody was raised against the middle region of MARVELD2

Purification: Affinity purified

Immunogen: MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MARVELD2 Blocking Peptide, catalog no. 33R-7179, is also available for use as a blocking control in assays to test for specificity of this MARVELD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tricellulin

Target: Tricellulin (MARVELD2)

Alternative Name: MARVELD2 (MARVELD2 Products)

Synonyms: Mrvldc2 antibody, BC003296 antibody, MARVD2 antibody, Tric antibody, Trica antibody, Tricb antibody, Tricc antibody, DFNB49 antibody, MRVLDC2 antibody, MARVEL domain containing 2 antibody, MARVEL (membrane-associating) domain containing 2 antibody, Marveld2 antibody, MARVELD2 antibody

Background: Tight junctions (TJ) prevent leakage of solutes through the paracellular pathway of epithelial cells. MARVELD2, or tricellulin (TRIC), is an integral membrane protein concentrated at the vertically oriented TJ strands of tricellular contacts.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Cell-Cell Junction Organization