TGFB2 antibody (Middle Region)

Catalog No. ABIN634909

Product Details anti-TGFB2 Antibody

Target: TGFB2 (Transforming Growth Factor, beta 2 (TGFB2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TGFB2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TGF beta 2 antibody was raised against the middle region of TGFB2

Purification: Affinity purified

Immunogen: TGF beta 2 antibody was raised using the middle region of TGFB2 corresponding to a region with amino acids NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TGF beta 2 Blocking Peptide, catalog no. 33R-6785, is also available for use as a blocking control in assays to test for specificity of this TGF beta 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGFB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TGFB2

Target: TGFB2 (Transforming Growth Factor, beta 2 (TGFB2))

Alternative Name: TGF beta 2 (TGFB2 Products)

Synonyms: LDS4 antibody, TGF-beta2 antibody, tgf-beta2 antibody, tgfb2-A antibody, BB105277 antibody, Tgf-beta2 antibody, Tgfb-2 antibody, TGF-beta 2 antibody, Tgfbr2T antibody, TGFB2 antibody, TGFbeta2 antibody, MGF antibody, TGF-B2 antibody, transforming growth factor beta 2 antibody, transforming growth factor beta 2 L homeolog antibody, transforming growth factor, beta 2 antibody, transforming growth factor, beta receptor 2 antibody, TGFB2 antibody, tgfb2.L antibody, Tgfb2 antibody, Tgfbr2 antibody, tgfb2 antibody

Background: This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Production of Molecular Mediator of Immune Response, Protein targeting to Nucleus