DNAJB12 antibody

Catalog No. ABIN634915

Product Details anti-DNAJB12 Antibody

Target: DNAJB12 (DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJB12 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DNAJB12 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNAJB12 Blocking Peptide, catalog no. 33R-4048, is also available for use as a blocking control in assays to test for specificity of this DNAJB12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJB12

Target: DNAJB12 (DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12))

Alternative Name: DNAJB12 (DNAJB12 Products)

Synonyms: dnajb12 antibody, wu:fc16f06 antibody, wu:fi38b10 antibody, MGC82876 antibody, DNAJB12 antibody, DJ10 antibody, Dj10 antibody, mDj10 antibody, DnaJ (Hsp40) homolog, subfamily B, member 12a antibody, DnaJ heat shock protein family (Hsp40) member B12 antibody, DnaJ heat shock protein family (Hsp40) member B12 S homeolog antibody, dnajb12a antibody, DNAJB12 antibody, dnajb12.S antibody, dnajb12 antibody, Dnajb12 antibody

Background: DNAJB12 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity.

Molecular Weight: 42 kDa (MW of target protein)