RNF144B antibody (Middle Region)

Catalog No. ABIN634924

Product Details anti-RNF144B Antibody

Target: RNF144B (Ring Finger Protein 144B (RNF144B))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF144B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF144 B antibody was raised against the middle region of RNF144

Purification: Affinity purified

Immunogen: RNF144 B antibody was raised using the middle region of RNF144 corresponding to a region with amino acids KHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF144B Blocking Peptide, catalog no. 33R-4424, is also available for use as a blocking control in assays to test for specificity of this RNF144B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF140 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF144B

Target: RNF144B (Ring Finger Protein 144B (RNF144B))

Alternative Name: RNF144B (RNF144B Products)

Synonyms: IBRDC2 antibody, PIR2 antibody, bA528A10.3 antibody, p53RFP antibody, BC025007 antibody, E130105P19Rik antibody, Ibrdc2 antibody, Pir2 antibody, ring finger protein 144B antibody, RNF144B antibody, Rnf144b antibody

Background: RNF144B is an E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2.

Molecular Weight: 34 kDa (MW of target protein)