Patched 1 antibody

Catalog No. ABIN634927

Product Details anti-Patched 1 Antibody

Target: Patched 1 (PTCH1)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Patched 1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTCH1 Blocking Peptide, catalog no. 33R-9121, is also available for use as a blocking control in assays to test for specificity of this PTCH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTCH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Patched 1

Target: Patched 1 (PTCH1)

Alternative Name: PTCH1 (PTCH1 Products)

Synonyms: BCNS antibody, HPE7 antibody, NBCCS antibody, PTC antibody, PTC1 antibody, PTCH antibody, PTCH11 antibody, lep antibody, ptc1 antibody, ptc2 antibody, Ptch antibody, Ptch2 antibody, Ptc-1 antibody, XPtc1 antibody, patched antibody, patched1 antibody, A230106A15Rik antibody, Ptc antibody, Ptc1 antibody, mes antibody, patched 1 antibody, patched 1 L homeolog antibody, Protein patched homolog 1 antibody, PTCH1 antibody, ptch1 antibody, Ptch1 antibody, ptch1.L antibody, ptc-1 antibody

Background: PTCH1 is a member of the patched gene family. The protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. It functions as a tumor suppressor. Mutations of its gene have been associated with nevoid basal cell carcinoma syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Hedgehog Signaling, Carbohydrate Homeostasis, Tube Formation