ATP1B1 antibody (Middle Region)

Catalog No. ABIN634933

Product Details anti-ATP1B1 Antibody

Target: ATP1B1 (ATPase, Na+/K+ Transporting, beta 1 Polypeptide (ATP1B1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP1B1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ATP1 B1 antibody was raised against the middle region of ATP1 1

Purification: Affinity purified

Immunogen: ATP1 B1 antibody was raised using the middle region of ATP1 1 corresponding to a region with amino acids VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP1B1 Blocking Peptide, catalog no. 33R-9698, is also available for use as a blocking control in assays to test for specificity of this ATP1B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP1B1

Target: ATP1B1 (ATPase, Na+/K+ Transporting, beta 1 Polypeptide (ATP1B1))

Alternative Name: ATP1B1 (ATP1B1 Products)

Synonyms: ATP1B antibody, Atp4b antibody, Atpb antibody, Atpb-1 antibody, NKbeta1 antibody, ATPBS antibody, atp1b1 antibody, atp1b1a antibody, cb710 antibody, ATPase Na+/K+ transporting subunit beta 1 antibody, ATPase, Na+/K+ transporting, beta 1 polypeptide antibody, ATPase beta chain antibody, ATP synthase CF1 beta subunit antibody, ATPase Na+/K+ transporting subunit beta 1 S homeolog antibody, ATPase, Na+/K+ transporting, beta 1b polypeptide antibody, ATP1B1 antibody, Atp1b1 antibody, atpB antibody, atp1b1.S antibody, atp1b1b antibody

Background: ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Ribonucleoside Biosynthetic Process, SARS-CoV-2 Protein Interactome