ATP1B1 antibody (Middle Region)
-
- Target See all ATP1B1 Antibodies
- ATP1B1 (ATPase, Na+/K+ Transporting, beta 1 Polypeptide (ATP1B1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP1B1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ATP1 B1 antibody was raised against the middle region of ATP1 1
- Purification
- Affinity purified
- Immunogen
- ATP1 B1 antibody was raised using the middle region of ATP1 1 corresponding to a region with amino acids VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL
- Top Product
- Discover our top product ATP1B1 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP1B1 Blocking Peptide, catalog no. 33R-9698, is also available for use as a blocking control in assays to test for specificity of this ATP1B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP1B1 (ATPase, Na+/K+ Transporting, beta 1 Polypeptide (ATP1B1))
- Alternative Name
- ATP1B1 (ATP1B1 Products)
- Synonyms
- ATP1B antibody, Atp4b antibody, Atpb antibody, Atpb-1 antibody, NKbeta1 antibody, ATPBS antibody, atp1b1 antibody, atp1b1a antibody, cb710 antibody, ATPase Na+/K+ transporting subunit beta 1 antibody, ATPase, Na+/K+ transporting, beta 1 polypeptide antibody, ATPase beta chain antibody, ATP synthase CF1 beta subunit antibody, ATPase Na+/K+ transporting subunit beta 1 S homeolog antibody, ATPase, Na+/K+ transporting, beta 1b polypeptide antibody, ATP1B1 antibody, Atp1b1 antibody, atpB antibody, atp1b1.S antibody, atp1b1b antibody
- Background
- ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis, Ribonucleoside Biosynthetic Process, SARS-CoV-2 Protein Interactome
-