LST-3TM12 antibody (Middle Region)
-
- Target See all LST-3TM12 products
- LST-3TM12 (Organic Anion Transporter LST-3b (LST-3TM12))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LST-3TM12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LST-3 TM12 antibody was raised against the middle region of LST-3 M12
- Purification
- Affinity purified
- Immunogen
- LST-3 TM12 antibody was raised using the middle region of LST-3 M12 corresponding to a region with amino acids RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLE
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LST-3TM12 Blocking Peptide, catalog no. 33R-7806, is also available for use as a blocking control in assays to test for specificity of this LST-3TM12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LST-0 M12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LST-3TM12 (Organic Anion Transporter LST-3b (LST-3TM12))
- Alternative Name
- LST-3TM12 (LST-3TM12 Products)
- Synonyms
- LST-3 antibody, LST-3TM12 antibody, LST3 antibody, SLC21A21 antibody, solute carrier organic anion transporter family member 1B7 (putative) antibody, SLCO1B7 antibody
- Background
- The function of LST-3TM12 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 71 kDa (MW of target protein)
-