GIMAP5 antibody (Middle Region)

Catalog No. ABIN634956

Product Details anti-GIMAP5 Antibody

Target: GIMAP5 (GTPase, IMAP Family Member 5 (GIMAP5))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GIMAP5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GIMAP5 antibody was raised against the middle region of GIMAP5

Purification: Affinity purified

Immunogen: GIMAP5 antibody was raised using the middle region of GIMAP5 corresponding to a region with amino acids CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GIMAP5 Blocking Peptide, catalog no. 33R-1678, is also available for use as a blocking control in assays to test for specificity of this GIMAP5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIMAP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GIMAP5

Target: GIMAP5 (GTPase, IMAP Family Member 5 (GIMAP5))

Alternative Name: GIMAP5 (GIMAP5 Products)

Synonyms: HIMAP3 antibody, IAN-5 antibody, IAN4 antibody, IAN4L1 antibody, IAN5 antibody, IMAP3 antibody, IROD antibody, Ian4l1 antibody, Ian5 antibody, D630024P16 antibody, E230026N22Rik antibody, GTPase, IMAP family member 5 antibody, GTPase IMAP family member 5 antibody, GIMAP5 antibody, Gimap5 antibody, LOC463896 antibody

Background: GIMAP5 belongs to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response