Cyclin M2 antibody (Middle Region)

Catalog No. ABIN634969

Product Details anti-Cyclin M2 Antibody

Target: Cyclin M2 (CNNM2)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cyclin M2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cyclin M2 antibody was raised against the middle region of CNNM2

Purification: Affinity purified

Immunogen: Cyclin M2 antibody was raised using the middle region of CNNM2 corresponding to a region with amino acids EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cyclin M2 Blocking Peptide, catalog no. 33R-2471, is also available for use as a blocking control in assays to test for specificity of this Cyclin M2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNNM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cyclin M2

Target: Cyclin M2 (CNNM2)

Alternative Name: Cyclin M2 (CNNM2 Products)

Synonyms: acdp4 antibody, cnnm4 antibody, ACDP2 antibody, AU015877 antibody, AW048635 antibody, Acdp2 antibody, Clp2 antibody, cyclin and CBS domain divalent metal cation transport mediator 2 antibody, metal transporter CNNM2 antibody, cyclin M2 antibody, CNNM2 antibody, cnnm2 antibody, LOC100059801 antibody, Cnnm2 antibody

Background: CNNM2 is a divalent metal cation transporter. CNNM2 mediates transport of divalent metal cations in an order of Mg2+ > Co2+ > Mn2+ > Sr2+ > Ba2+ > Cu2+ > Fe2+.

Molecular Weight: 96 kDa (MW of target protein)