FAM19A3 antibody (Middle Region)
-
- Target See all FAM19A3 Antibodies
- FAM19A3 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A3 (FAM19A3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM19A3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM19 A3 antibody was raised against the middle region of FAM19 3
- Purification
- Affinity purified
- Immunogen
- FAM19 A3 antibody was raised using the middle region of FAM19 3 corresponding to a region with amino acids FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGV
- Top Product
- Discover our top product FAM19A3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM19A3 Blocking Peptide, catalog no. 33R-3058, is also available for use as a blocking control in assays to test for specificity of this FAM19A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM19A3 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A3 (FAM19A3))
- Alternative Name
- FAM19A3 (FAM19A3 Products)
- Synonyms
- TAFA-3 antibody, TAFA3 antibody, 7530404M11Rik antibody, Tafa-3 antibody, family with sequence similarity 19 member A3, C-C motif chemokine like antibody, family with sequence similarity 19, member A3 antibody, FAM19A3 antibody, Fam19a3 antibody
- Background
- FAM19A3 is a member of the TAFA family which is composed of five highly homologous small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells.
- Molecular Weight
- 18 kDa (MW of target protein)
-