LRRN3 antibody (N-Term)
-
- Target See all LRRN3 Antibodies
- LRRN3 (Leucine Rich Repeat Neuronal 3 (LRRN3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRRN3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LRRN3 antibody was raised against the N terminal of LRRN3
- Purification
- Affinity purified
- Immunogen
- LRRN3 antibody was raised using the N terminal of LRRN3 corresponding to a region with amino acids ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL
- Top Product
- Discover our top product LRRN3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRRN3 Blocking Peptide, catalog no. 33R-2582, is also available for use as a blocking control in assays to test for specificity of this LRRN3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRN3 (Leucine Rich Repeat Neuronal 3 (LRRN3))
- Alternative Name
- LRRN3 (LRRN3 Products)
- Synonyms
- nlrr3 antibody, nlrr-3 antibody, MGC146637 antibody, FIGLER5 antibody, NLRR-3 antibody, NLRR3 antibody, Nlrr3 antibody, leucine rich repeat neuronal 3 antibody, leucine rich repeat protein 3, neuronal antibody, LRRN3 antibody, lrrn3 antibody, Lrrn3 antibody
- Background
- LRRN3 is a single-pass type I membrane protein. It contains 1 fibronectin type-III domain, 1 Ig-like C2-type (immunoglobulin-like) domain and 12 LRR (leucine-rich) repeats. The function of the LRRN3 protein remains unknown.
- Molecular Weight
- 79 kDa (MW of target protein)
-