HLA-F antibody (N-Term)

Catalog No. ABIN635005

Product Details anti-HLA-F Antibody

Target: HLA-F (HLAF) (HLA Class I alpha F (HLAF))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HLA-F antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HLA-F antibody was raised against the N terminal of HLA-F

Purification: Affinity purified

Immunogen: HLA-F antibody was raised using the N terminal of HLA-F corresponding to a region with amino acids PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HLA-F Blocking Peptide, catalog no. 33R-7437, is also available for use as a blocking control in assays to test for specificity of this HLA-F antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-F antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HLA-F

Target: HLA-F (HLAF) (HLA Class I alpha F (HLAF))

Alternative Name: HLA-F (HLAF Products)

Synonyms: HLAF antibody, CDA12 antibody, HLA-5.4 antibody, HLA-CDA12 antibody, major histocompatibility complex, class I, F antibody, HLA-F antibody

Background: HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process