HLA-F antibody (N-Term)
-
- Target See all HLA-F (HLAF) Antibodies
- HLA-F (HLAF) (HLA Class I alpha F (HLAF))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HLA-F antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HLA-F antibody was raised against the N terminal of HLA-F
- Purification
- Affinity purified
- Immunogen
- HLA-F antibody was raised using the N terminal of HLA-F corresponding to a region with amino acids PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN
- Top Product
- Discover our top product HLAF Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HLA-F Blocking Peptide, catalog no. 33R-7437, is also available for use as a blocking control in assays to test for specificity of this HLA-F antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-F antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HLA-F (HLAF) (HLA Class I alpha F (HLAF))
- Alternative Name
- HLA-F (HLAF Products)
- Synonyms
- HLAF antibody, CDA12 antibody, HLA-5.4 antibody, HLA-CDA12 antibody, major histocompatibility complex, class I, F antibody, HLA-F antibody
- Background
- HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-