ROBO2 antibody
-
- Target See all ROBO2 Antibodies
- ROBO2 (Roundabout, Axon Guidance Receptor, Homolog 2 (ROBO2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ROBO2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ROBO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK
- Top Product
- Discover our top product ROBO2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ROBO2 Blocking Peptide, catalog no. 33R-7307, is also available for use as a blocking control in assays to test for specificity of this ROBO2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROBO2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ROBO2 (Roundabout, Axon Guidance Receptor, Homolog 2 (ROBO2))
- Alternative Name
- ROBO2 (ROBO2 Products)
- Synonyms
- SAX3 antibody, ROBO2 antibody, CG14347 antibody, CG14348 antibody, CG5481 antibody, CG5574 antibody, CT17326 antibody, D-Robo2 antibody, D-robo2 antibody, Dmel\\CG5481 antibody, Robo 2 antibody, Robo-2 antibody, Robo2 antibody, anon-EST:Liang-1.75 antibody, clone 1.75 antibody, dRobo-2 antibody, fus4 antibody, robo-2 antibody, robo2 antibody, unp1881 antibody, 2600013A04Rik antibody, 9430089E08Rik antibody, BB097918 antibody, D230004I22Rik antibody, mKIAA1568 antibody, sax3 antibody, roundabout guidance receptor 2 antibody, roundabout 2 antibody, roundabout, axon guidance receptor, homolog 2 (Drosophila) antibody, roundabout guidance receptor 2 S homeolog antibody, ROBO2 antibody, Robo2 antibody, robo2 antibody, robo2.S antibody
- Background
- ROBO2 belongs to the ROBO family, part of the immunoglobulin superfamily proteins that are highly conserved from fly to human. ROBO2 is a receptor for SLIT2, molecules known to function in axon guidance and cell migration. Defects in this gene are the cause of vesicoureteral reflux type 2. Alternatively spliced transcript variants encoding different isoforms have been described for ROBO2.
- Molecular Weight
- 151 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-