MFN2 antibody (C-Term)

Catalog No. ABIN635034

Product Details anti-MFN2 Antibody

Target: MFN2 (Mitofusin 2 (MFN2))

Binding Specificity: C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MFN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Mitofusin 2 antibody was raised against the C terminal of MFN2

Purification: Affinity purified

Immunogen: Mitofusin 2 antibody was raised using the C terminal of MFN2 corresponding to a region with amino acids LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Mitofusin 2 Blocking Peptide, catalog no. 33R-4923, is also available for use as a blocking control in assays to test for specificity of this Mitofusin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MFN2

Target: MFN2 (Mitofusin 2 (MFN2))

Alternative Name: Mitofusin 2 (MFN2 Products)

Synonyms: CG3869 antibody, Dmel\\CG3869 antibody, MARF antibody, Marf-1 antibody, Mfn antibody, anon-WO0125274.3 antibody, dMFN antibody, dMfn antibody, dmfn antibody, marf antibody, mfn antibody, mfn2 antibody, MFN2 antibody, hsg antibody, cmt2a antibody, cprp1 antibody, cmt2a2 antibody, CMT2A antibody, CMT2A2 antibody, CPRP1 antibody, HSG antibody, D630023P19Rik antibody, Fzo antibody, mg:cb01g09 antibody, si:dkeyp-104h9.2 antibody, wu:fb79a11 antibody, mitofusin 2 antibody, Mitochondrial assembly regulatory factor antibody, mitofusin-2 antibody, mitofusin 2 L homeolog antibody, MFN2 antibody, Marf antibody, mfn2 antibody, LOC100186475 antibody, Mfn2 antibody, mfn2.L antibody

Background: MFN2 is a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. It is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke.

Molecular Weight: 86 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development