COX10 antibody (Middle Region)

Catalog No. ABIN635038

Product Details anti-COX10 Antibody

Target: COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COX10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: COX10 antibody was raised against the middle region of COX10

Purification: Affinity purified

Immunogen: COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COX10 Blocking Peptide, catalog no. 33R-1421, is also available for use as a blocking control in assays to test for specificity of this COX10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COX10

Target: COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))

Alternative Name: COX10 (COX10 Products)

Background: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is a heme A farnesyltransferase, which is not a structural subunit but required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX.

Molecular Weight: 49 kDa (MW of target protein)