SLC25A6 antibody
-
- Target See all SLC25A6 Antibodies
- SLC25A6 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 6 (SLC25A6))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC25A6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC25 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ
- Top Product
- Discover our top product SLC25A6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC25A6 Blocking Peptide, catalog no. 33R-5346, is also available for use as a blocking control in assays to test for specificity of this SLC25A6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A6 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 6 (SLC25A6))
- Alternative Name
- SLC25A6 (SLC25A6 Products)
- Synonyms
- 2 antibody, 3 antibody, AAC3 antibody, ANT antibody, ANT 2 antibody, ANT 3 antibody, ANT3 antibody, ANT3Y antibody, SLC25A5 antibody, RGD1560896 antibody, wu:fj78b08 antibody, si:dkey-21o13.4 antibody, SLC25A6 antibody, solute carrier family 25 member 6 antibody, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 antibody, SLC25A6 antibody, Slc25a6 antibody, slc25a6 antibody
- Background
- SLC25A6 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. SLC25A6 may participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.
- Molecular Weight
- 33 kDa (MW of target protein)
-