CYBA antibody (Middle Region)

Catalog No. ABIN635056

Product Details anti-CYBA Antibody

Target: CYBA (Cytochrome B-245, alpha Polypeptide (CYBA))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYBA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYBA antibody was raised against the middle region of CYBA

Purification: Affinity purified

Immunogen: CYBA antibody was raised using the middle region of CYBA corresponding to a region with amino acids TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYBA Blocking Peptide, catalog no. 33R-9120, is also available for use as a blocking control in assays to test for specificity of this CYBA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYBA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYBA

Target: CYBA (Cytochrome B-245, alpha Polypeptide (CYBA))

Alternative Name: CYBA (CYBA Products)

Synonyms: zgc:66077 antibody, MGC80750 antibody, CYBA antibody, p22-phox antibody, p22phox antibody, p22-PHOX antibody, b558 antibody, nmf333 antibody, P22-PHOX antibody, cytochrome b-245, alpha polypeptide antibody, cytochrome b-245 alpha polypeptide L homeolog antibody, cytochrome b-245 alpha polypeptide antibody, cytochrome b-245 light chain-like antibody, cytochrome b-245 alpha chain antibody, p22-phox antibody, cyba antibody, cyba.L antibody, CYBA antibody, LOC101328418 antibody, Cyba antibody

Background: Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes.

Molecular Weight: 21 kDa (MW of target protein)

Pathways: Regulation of Systemic Arterial Blood Pressure by Hormones, Carbohydrate Homeostasis