SLC25A20 antibody

Catalog No. ABIN635058

Product Details anti-SLC25A20 Antibody

Target: SLC25A20 (Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20))

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A20 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC25 A20 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A20 Blocking Peptide, catalog no. 33R-3287, is also available for use as a blocking control in assays to test for specificity of this SLC25A20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A20

Target: SLC25A20 (Solute Carrier Family 25 (Carnitine/acylcarnitine Translocase), Member 20 (SLC25A20))

Alternative Name: SLC25A20 (SLC25A20 Products)

Synonyms: 5848 antibody, BG:DS02740.15 antibody, CACT antibody, CG5848 antibody, Cact antibody, Dmel\\CG5848 antibody, cac antibody, dip6 antibody, fs(2)ltoRN48 antibody, n(2)k17003 antibody, cact antibody, dif-1 antibody, SLC25A20 antibody, DKFZp468F1219 antibody, zgc:77760 antibody, PRKAR2A antibody, CAC antibody, 1110007P09Rik antibody, C78826 antibody, mCAC antibody, cactus antibody, solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 antibody, solute carrier family 25 member 20 antibody, solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 L homeolog antibody, solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20 antibody, cact antibody, slc25a20 antibody, SLC25A20 antibody, Slc25a20 antibody, slc25a20.L antibody

Background: SLC25A20 is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space.It mediates the transport of acylcarnitines into mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. Mutations in this gene are associated with carnitine-acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: TCR Signaling, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location, Toll-Like Receptors Cascades