Slc25a1 antibody

Catalog No. ABIN635081

Product Details anti-Slc25a1 Antibody

Target: Slc25a1 (Solute Carrier Family 25 (Mitochondrial Carrier, Citrate Transporter), Member 1 (Slc25a1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Slc25a1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC25 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A1 Blocking Peptide, catalog no. 33R-6746, is also available for use as a blocking control in assays to test for specificity of this SLC25A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Slc25a1

Target: Slc25a1 (Solute Carrier Family 25 (Mitochondrial Carrier, Citrate Transporter), Member 1 (Slc25a1))

Alternative Name: SLC25A1 (Slc25a1 Products)

Synonyms: MGC53598 antibody, slc25a1 antibody, zgc:63578 antibody, ctp antibody, slc20a3 antibody, CG31305 antibody, CG6782 antibody, DmCIC antibody, Dmel\\CG6782 antibody, SLC25A1 antibody, anon-WO0140519.12 antibody, l(3)EP3364 antibody, NV14384 antibody, 1300019P08Rik antibody, 2610100G11Rik antibody, AI194714 antibody, Ctp antibody, Dgsj antibody, Slc20a3 antibody, Cic antibody, CTP antibody, D2L2AD antibody, SEA antibody, SLC20A3 antibody, solute carrier family 25 member 1 L homeolog antibody, solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1a antibody, solute carrier family 25 member 1 antibody, scheggia antibody, solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1 antibody, solute carrier family 25 (mitochondrial carrier, citrate transporter), member 1 antibody, slc25a1.L antibody, slc25a1a antibody, slc25a1 antibody, SLC25A1 antibody, sea antibody, Slc25a1 antibody

Background: The mitochondrial tricarboxylate transporter (also called citrate transport protein, or CTP) is responsible for the movement of citrate across the mitochondrial inner membrane.

Molecular Weight: 34 kDa (MW of target protein)