SLC25A39 antibody (C-Term)

Catalog No. ABIN635082

Product Details anti-SLC25A39 Antibody

Target: SLC25A39 (Solute Carrier Family 25, Member 39 (SLC25A39))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A39 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SLC25 A39 antibody was raised against the C terminal of SLC25 39

Purification: Affinity purified

Immunogen: SLC25 A39 antibody was raised using the C terminal of SLC25 39 corresponding to a region with amino acids RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A39 Blocking Peptide, catalog no. 33R-8252, is also available for use as a blocking control in assays to test for specificity of this SLC25A39 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A39

Target: SLC25A39 (Solute Carrier Family 25, Member 39 (SLC25A39))

Alternative Name: SLC25A39 (SLC25A39 Products)

Synonyms: SLC25A39 antibody, zgc:63736 antibody, CGI69 antibody, 3010027G13Rik antibody, D11Ertd333e antibody, RGD1306193 antibody, solute carrier family 25 member 39 antibody, solute carrier family 25, member 39 antibody, solute carrier family 25 member 39 L homeolog antibody, slc25a39 antibody, SLC25A39 antibody, slc25a39.L antibody, Slc25a39 antibody

Background: SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.

Molecular Weight: 39 kDa (MW of target protein)