SLC25A22 antibody

Catalog No. ABIN635084

Product Details anti-SLC25A22 Antibody

Target: SLC25A22 (Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A22 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC25 A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A22 Blocking Peptide, catalog no. 33R-9708, is also available for use as a blocking control in assays to test for specificity of this SLC25A22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A22

Target: SLC25A22 (Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22))

Alternative Name: SLC25A22 (SLC25A22 Products)

Synonyms: 1300006L01Rik antibody, AI060884 antibody, Gc1 antibody, GC1 antibody, RGD1307826 antibody, EIEE3 antibody, NET44 antibody, solute carrier family 25 (mitochondrial carrier, glutamate), member 22 antibody, solute carrier family 25 member 22 antibody, Slc25a22 antibody, SLC25A22 antibody

Background: The SLC25 family is mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane. SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H+ symporters, the other being SLC25A18.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport