COQ2 antibody

Catalog No. ABIN635093

Product Details anti-COQ2 Antibody

Target: COQ2 (Coenzyme Q2 Homolog, Prenyltransferase (COQ2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COQ2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: COQ2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COQ2 Blocking Peptide, catalog no. 33R-3061, is also available for use as a blocking control in assays to test for specificity of this COQ2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COQ2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COQ2

Target: COQ2 (Coenzyme Q2 Homolog, Prenyltransferase (COQ2))

Alternative Name: COQ2 (COQ2 Products)

Synonyms: CG9613 antibody, COQ2 antibody, Dmel\\CG9613 antibody, coq2 antibody, sbo antibody, CL640 antibody, COQ10D1 antibody, MSA1 antibody, RGD1306722 antibody, zgc:162600 antibody, 2310002F18Rik antibody, Coenzyme Q biosynthesis protein 2 antibody, coenzyme Q2, polyprenyltransferase antibody, coenzyme Q2 4-hydroxybenzoate polyprenyltransferase antibody, 4-hydroxybenzoate polyprenyltransferase, mitochondrial antibody, Coq2 antibody, COQ2 antibody, coq2 antibody, coq-2 antibody

Background: COQ2 catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. COQ2 mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.

Molecular Weight: 42 kDa (MW of target protein)