TRPM2 antibody (N-Term)

Catalog No. ABIN635099

Product Details anti-TRPM2 Antibody

Target: TRPM2 (Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRPM2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRPM2 antibody was raised against the N terminal of TRPM2

Purification: Affinity purified

Immunogen: TRPM2 antibody was raised using the N terminal of TRPM2 corresponding to a region with amino acids VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRPM2 Blocking Peptide, catalog no. 33R-9418, is also available for use as a blocking control in assays to test for specificity of this TRPM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRPM2

Target: TRPM2 (Transient Receptor Potential Cation Channel, Subfamily M, Member 2 (TRPM2))

Alternative Name: TRPM2 (TRPM2 Products)

Synonyms: EREG1 antibody, KNP3 antibody, LTRPC2 antibody, NUDT9H antibody, NUDT9L1 antibody, TRPC7 antibody, Trpm2-predicted antibody, TRPM2 antibody, si:ch73-263b18.1 antibody, 9830168K16Rik antibody, C79133 antibody, Trp7 antibody, Trrp7 antibody, transient receptor potential cation channel subfamily M member 2 antibody, transient receptor potential cation channel, subfamily M, member 2 antibody, transient receptor potential cation channel subfamily C member 7 antibody, TRPM2 antibody, Trpm2 antibody, trpm2 antibody, TRPC7 antibody

Background: The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.

Molecular Weight: 171 kDa (MW of target protein)