OR5T2 antibody (C-Term)

Catalog No. ABIN635104

Product Details anti-OR5T2 Antibody

Target: OR5T2 (Olfactory Receptor, Family 5, Subfamily T, Member 2 (OR5T2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OR5T2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OR5 T2 antibody was raised against the C terminal of OR5 2

Purification: Affinity purified

Immunogen: OR5 T2 antibody was raised using the C terminal of OR5 2 corresponding to a region with amino acids DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OR5T2 Blocking Peptide, catalog no. 33R-2075, is also available for use as a blocking control in assays to test for specificity of this OR5T2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OR5T2

Target: OR5T2 (Olfactory Receptor, Family 5, Subfamily T, Member 2 (OR5T2))

Alternative Name: OR5T2 (OR5T2 Products)

Synonyms: OR11-177 antibody, olfactory receptor family 5 subfamily T member 2 antibody, olfactory receptor, family 5, subfamily T, member 2 antibody, olfactory receptor 1086-like antibody, OR5T2 antibody, LOC100727026 antibody

Background: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

Molecular Weight: 39 kDa (MW of target protein)