GDAP1L1 antibody (N-Term)

Catalog No. ABIN635125

Product Details anti-GDAP1L1 Antibody

Target: GDAP1L1 (Ganglioside-Induced Differentiation-Associated Protein 1-Like 1 (GDAP1L1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GDAP1L1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GDAP1 L1 antibody was raised against the N terminal of GDAP1 1

Purification: Affinity purified

Immunogen: GDAP1 L1 antibody was raised using the N terminal of GDAP1 1 corresponding to a region with amino acids ERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GDAP1L1 Blocking Peptide, catalog no. 33R-2689, is also available for use as a blocking control in assays to test for specificity of this GDAP1L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDAP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GDAP1L1

Target: GDAP1L1 (Ganglioside-Induced Differentiation-Associated Protein 1-Like 1 (GDAP1L1))

Alternative Name: GDAP1L1 (GDAP1L1 Products)

Synonyms: GDAP1L1 antibody, MGC146673 antibody, dJ881L22.1 antibody, dJ995J12.1.1 antibody, Gdap1l antibody, ganglioside induced differentiation associated protein 1 like 1 antibody, ganglioside induced differentiation associated protein 1-like 1 antibody, ganglioside-induced differentiation-associated protein 1-like 1 antibody, GDAP1L1 antibody, gdap1l1 antibody, Gdap1l1 antibody

Background: The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1). A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. GDAP1L1 is similar in sequence to the human GDAP1 protein.

Molecular Weight: 42 kDa (MW of target protein)