BVES antibody (Middle Region)

Catalog No. ABIN635131

Product Details anti-BVES Antibody

Target: BVES (Blood Vessel Epicardial Substance (BVES))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BVES antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BVES antibody was raised against the middle region of BVES

Purification: Affinity purified

Immunogen: BVES antibody was raised using the middle region of BVES corresponding to a region with amino acids YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BVES Blocking Peptide, catalog no. 33R-10170, is also available for use as a blocking control in assays to test for specificity of this BVES antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BVES antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BVES

Target: BVES (Blood Vessel Epicardial Substance (BVES))

Alternative Name: BVES (BVES Products)

Synonyms: HBVES antibody, POP1 antibody, POPDC1 antibody, Pop1 antibody, Popdc1 antibody, mBVES antibody, Popeye-1 antibody, Xbves antibody, Xbves-A antibody, Xpop-1 antibody, Xpop-1-A antibody, pop-1 antibody, pop1 antibody, pop1-A antibody, popdc1 antibody, popdc1-A antibody, zgc:86887 antibody, BVES antibody, Xpop-1-B antibody, bves antibody, pop1-B antibody, popdc1-B antibody, hbves antibody, blood vessel epicardial substance antibody, blood vessel epicardial substance L homeolog antibody, blood vessel epicardial substance S homeolog antibody, BVES antibody, Bves antibody, bves.L antibody, bves antibody, bves.S antibody

Background: This gene encodes a member of the POP family of proteins containing three putative transmembrane domains. This gene is expressed in cardiac and skeletal muscle and may play an important role in development of these tissues. The mouse ortholog may be involved in the regeneration of adult skeletal muscle and may act as a cell adhesion molecule in coronary vasculogenesis. Two transcript variants encoding the same protein have been found for this gene.

Molecular Weight: 41 kDa (MW of target protein)