ATP6V0C antibody (Middle Region)

Catalog No. ABIN635137

Product Details anti-ATP6V0C Antibody

Target: ATP6V0C (ATPase, H+ Transporting, Lysosomal 16kDa, V0 Subunit C (ATP6V0C))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP6V0C antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ATP6 V6 antibody was raised against the middle region of ATP6 6

Purification: Affinity purified

Immunogen: ATP6 V6 antibody was raised using the middle region of ATP6 6 corresponding to a region with amino acids VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP6V0C Blocking Peptide, catalog no. 33R-9868, is also available for use as a blocking control in assays to test for specificity of this ATP6V0C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP6V0C

Target: ATP6V0C (ATPase, H+ Transporting, Lysosomal 16kDa, V0 Subunit C (ATP6V0C))

Alternative Name: ATP6V0C (ATP6V0C Products)

Synonyms: ATP6C antibody, ATP6L antibody, ATPL antibody, VATL antibody, VPPC antibody, Vma3 antibody, Atp6c antibody, Atp6c2 antibody, Atp6l antibody, Atpl antibody, Atpl-rs1 antibody, PL16 antibody, CHUNP6904 antibody, atp6l antibody, atp6v0c antibody, cb993 antibody, fb57d09 antibody, wu:fb57d09 antibody, atp6c antibody, atpl antibody, ductin antibody, vatl antibody, vma3 antibody, PLP antibody, wu:fc74d11 antibody, zgc:111904 antibody, zgc:77708 antibody, ATPase H+ transporting V0 subunit c antibody, ATPase, H+ transporting, lysosomal V0 subunit C antibody, ATPase H+ transporting V0 subunit C antibody, ATPase, H+ transporting, lysosomal, V0 subunit ca antibody, ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c antibody, ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c L homeolog antibody, V-type proton ATPase 16 kDa proteolipid subunit antibody, ATPase, H+ transporting, lysosomal, V0 subunit cb antibody, ATP6V0C antibody, Atp6v0c antibody, atp6v0ca antibody, atp6v0c antibody, atp6v0c.L antibody, LOC696755 antibody, atp6v0cb antibody

Background: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport