SLC6A5 antibody
-
- Target See all SLC6A5 Antibodies
- SLC6A5 (Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC6A5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC6 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE
- Top Product
- Discover our top product SLC6A5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC6A5 Blocking Peptide, catalog no. 33R-5068, is also available for use as a blocking control in assays to test for specificity of this SLC6A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC6A5 (Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5))
- Alternative Name
- SLC6A5 (SLC6A5 Products)
- Synonyms
- SLC6A5 antibody, Glyt2 antibody, prestin antibody, GLYT-2 antibody, GLYT2 antibody, HKPX3 antibody, NET1 antibody, solute carrier family 6 member 5 antibody, solute carrier family 6 (neurotransmitter transporter, glycine), member 5 antibody, SLC6A5 antibody, Slc6a5 antibody
- Background
- This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission.
- Molecular Weight
- 87 kDa (MW of target protein)
-