UNC50 antibody

Catalog No. ABIN635144

Product Details anti-UNC50 Antibody

Target: UNC50 (Unc-50 Homolog (UNC50))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UNC50 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: UNC50 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UNC50 Blocking Peptide, catalog no. 33R-5291, is also available for use as a blocking control in assays to test for specificity of this UNC50 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UNC50

Target: UNC50 (Unc-50 Homolog (UNC50))

Alternative Name: UNC50 (UNC50 Products)

Synonyms: GMH1 antibody, UNCL antibody, URP antibody, 1110002A21Rik antibody, Uncl antibody, zgc:56114 antibody, gmh1 antibody, unc50 antibody, uncl antibody, urp antibody, unc-50 inner nuclear membrane RNA binding protein antibody, unc-50 homolog (C. elegans) antibody, protein unc-50 homolog antibody, unc-50 homolog L homeolog antibody, unc-50 homolog S homeolog antibody, UNC50 antibody, Unc50 antibody, unc50 antibody, LOC550684 antibody, LOC100161482 antibody, unc50.L antibody, unc50.S antibody

Background: UNC50 belongs to the unc-50 family. It binds RNA. UNC50 may be involved in cell surface expression of neuronal nicotinic receptors.

Molecular Weight: 30 kDa (MW of target protein)