SV2A antibody (Middle Region)

Catalog No. ABIN635145

Product Details anti-SV2A Antibody

Target: SV2A (Synaptic Vesicle Glycoprotein 2A (SV2A))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SV2A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SV2 A antibody was raised against the middle region of SV2

Purification: Affinity purified

Immunogen: SV2 A antibody was raised using the middle region of SV2 corresponding to a region with amino acids LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SV2A Blocking Peptide, catalog no. 33R-4916, is also available for use as a blocking control in assays to test for specificity of this SV2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SV0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SV2A

Target: SV2A (Synaptic Vesicle Glycoprotein 2A (SV2A))

Alternative Name: SV2A (SV2A Products)

Synonyms: AI746429 antibody, mKIAA0736 antibody, Sv2 antibody, SV2 antibody, synaptic vesicle glycoprotein 2A antibody, synaptic vesicle glycoprotein 2 a antibody, synaptic vesicle glycoprotein 2a antibody, SV2A antibody, CpipJ_CPIJ017596 antibody, sv2a antibody, Sv2a antibody

Background: SV2A plays a role in the control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. It positively regulates vesicle fusion by maintaining the readily releasable pool of secretory vesicles.

Molecular Weight: 83 kDa (MW of target protein)