Reticulon 1 antibody (Middle Region)
-
- Target See all Reticulon 1 (RTN1) Antibodies
- Reticulon 1 (RTN1)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Reticulon 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RTN1 antibody was raised against the middle region of RTN1
- Purification
- Affinity purified
- Immunogen
- RTN1 antibody was raised using the middle region of RTN1 corresponding to a region with amino acids MAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE
- Top Product
- Discover our top product RTN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RTN1 Blocking Peptide, catalog no. 33R-5805, is also available for use as a blocking control in assays to test for specificity of this RTN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Reticulon 1 (RTN1)
- Alternative Name
- RTN1 (RTN1 Products)
- Synonyms
- NSP antibody, 0710005K15Rik antibody, 4930441F12Rik antibody, Nsp antibody, R75279 antibody, Rtn1-a antibody, Rtn1-b antibody, Rtn1-c antibody, reticulon-1 antibody, RTN1 antibody, RTN1-Cw antibody, rtn1 antibody, XRTN1-A antibody, XRTN1-C.1 antibody, xrtn1 antibody, xrtn1-c antibody, RTN1.2 antibody, Rtn1-C.2 antibody, rtn1-a antibody, rtn1b antibody, xRTN1 antibody, RTN1.1 antibody, rtn1a antibody, xrtn1-c.1 antibody, rtn1l antibody, wu:fa21b09 antibody, wu:fj35h01 antibody, reticulon 1 antibody, reticulon-1 antibody, reticulon 1 S homeolog antibody, reticulon 1 L homeolog antibody, reticulon 1b antibody, RTN1 antibody, Rtn1 antibody, rtn1 antibody, Rtnl1 antibody, LOC100580843 antibody, rtn1.S antibody, rtn1.L antibody, LOC100339591 antibody, rtn1b antibody
- Background
- Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.
- Molecular Weight
- 23 kDa (MW of target protein)
-