SPOCK3 antibody
-
- Target See all SPOCK3 Antibodies
- SPOCK3 (Sparc/osteonectin, Cwcv and Kazal-Like Domains Proteoglycan (Testican) 3 (SPOCK3))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPOCK3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SPOCK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKT
- Top Product
- Discover our top product SPOCK3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPOCK3 Blocking Peptide, catalog no. 33R-1758, is also available for use as a blocking control in assays to test for specificity of this SPOCK3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPOCK3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPOCK3 (Sparc/osteonectin, Cwcv and Kazal-Like Domains Proteoglycan (Testican) 3 (SPOCK3))
- Alternative Name
- SPOCK3 (SPOCK3 Products)
- Background
- Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 is a member of a novel Ca(2+)-binding family Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 encodes a member of a novel Ca(2+)-binding proteoglycan family.
- Molecular Weight
- 49 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-