Chromosome 6 Open Reading Frame 192 (C6orf192) (N-Term) antibody

Details for Product No. ABIN635175
Antigen
Epitope
N-Term
15
1
1
Reactivity
Human
19
16
16
2
2
1
1
1
1
Host
Rabbit
19
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
13
6
4
1
Options
Immunogen C6 ORF192 antibody was raised using the N terminal Of C6 rf192 corresponding to a region with amino acids ISAASVNLGSMMCYSILGPFFPKEAEKKGASNTIIGMIFGCFALFELLAS
Specificity C6 ORF192 antibody was raised against the N terminal Of C6 rf192
Purification Affinity purified
Antigen
Alternative Name C6ORF192 (C6orf192 Antibody Abstract)
Background This gene encodes a protein, which has high sequence similarity to rat, xenopus and zebrafish proteins. The protein function is unknown.
Molecular Weight 49 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

C6ORF192 Blocking Peptide, catalog no. 33R-4143, is also available for use as a blocking control in assays to test for specificity of this C6ORF192 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF192 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Chromosome 6 Open Reading Frame 192 (C6orf192) (N-Term) antibody (ABIN635175) C6ORF192 antibody used at 1 ug/ml to detect target protein.