SLC12A3 antibody
-
- Target See all SLC12A3 Antibodies
- SLC12A3 (Solute Carrier Family 12 (Sodium/Chloride Transporters), Member 3 (SLC12A3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC12A3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC12 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYC
- Top Product
- Discover our top product SLC12A3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC12A3 Blocking Peptide, catalog no. 33R-1342, is also available for use as a blocking control in assays to test for specificity of this SLC12A3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC12A3 (Solute Carrier Family 12 (Sodium/Chloride Transporters), Member 3 (SLC12A3))
- Alternative Name
- SLC12A3 (SLC12A3 Products)
- Synonyms
- SLC12A3 antibody, slc12a3 antibody, DKFZp469N2315 antibody, NCC antibody, NCCT antibody, TSC antibody, AI035291 antibody, solute carrier family 12 member 3 antibody, solute carrier family 12 (sodium/chloride transporter), member 3 antibody, solute carrier family 12, member 3 antibody, SLC12A3 antibody, slc12a3.2 antibody, Slc12a3 antibody
- Background
- This gene encodes a renal thiazide-sensitive sodium-chloride cotransporter that is important for electrolyte homeostasis. This cotransporter mediates sodium and chloride reabsorption in the distal convoluted tubule.
- Molecular Weight
- 114 kDa (MW of target protein)
-