TMEM57 antibody (Transmembrane Protein 57) (N-Term)

Details for Product anti-TMEM57 Antibody No. ABIN635187
Antigen
Epitope
N-Term
8
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
21
13
3
3
2
2
2
2
2
1
1
1
1
1
Host
Rabbit
22
Clonality
Polyclonal
Conjugate
This TMEM57 antibody is un-conjugated
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
17
9
9
1
Options
Immunogen TMEM57 antibody was raised using the N terminal of TMEM57 corresponding to a region with amino acids VVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVFFVCVAF
Specificity TMEM57 antibody was raised against the N terminal of TMEM57
Purification Affinity purified
Antigen
Alternative Name TMEM57
Background The function of TMEM57 protein has not been widely studied, and is yet to be fully elucidated.
Molecular Weight 76 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

TMEM57 Blocking Peptide, catalog no. 33R-9906, is also available for use as a blocking control in assays to test for specificity of this TMEM57 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM57 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Transmembrane Protein 57 (TMEM57) (N-Term) antibody (ABIN635187) TMEM57 antibody used at 1 ug/ml to detect target protein.