PTPN1 antibody (Middle Region)
-
- Target See all PTPN1 Antibodies
- PTPN1 (Protein tyrosine Phosphatase, Non-Receptor Type 1 (PTPN1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTPN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PTPN1 antibody was raised against the middle region of PTPN1
- Purification
- Affinity purified
- Immunogen
- PTPN1 antibody was raised using the middle region of PTPN1 corresponding to a region with amino acids SGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVL
- Top Product
- Discover our top product PTPN1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PTPN1 Blocking Peptide, catalog no. 33R-8491, is also available for use as a blocking control in assays to test for specificity of this PTPN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTPN1 (Protein tyrosine Phosphatase, Non-Receptor Type 1 (PTPN1))
- Alternative Name
- PTPN1 (PTPN1 Products)
- Synonyms
- PTPN1 antibody, PTP1B antibody, PTP-1B antibody, PTP-HA2 antibody, Ptp antibody, ptp1b antibody, wu:fk54h03 antibody, CPTP1 antibody, protein tyrosine phosphatase, non-receptor type 1 antibody, protein tyrosine phosphatase, non-receptor type 1 L homeolog antibody, PTPN1 antibody, Ptpn1 antibody, ptpn1 antibody, ptpn1.L antibody
- Background
- PTPN1 is the founding member of the protein tyrosine phosphatase (PTP) family. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation.
- Molecular Weight
- 50 kDa (MW of target protein)
- Pathways
- TLR Signaling, Response to Growth Hormone Stimulus, ER-Nucleus Signaling, Platelet-derived growth Factor Receptor Signaling
-