MPZL1 antibody (Middle Region)

Catalog No. ABIN635201

Product Details anti-MPZL1 Antibody

Target: MPZL1 (Myelin Protein Zero-Like 1 (MPZL1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPZL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MPZL1 antibody was raised against the middle region of MPZL1

Purification: Affinity purified

Immunogen: MPZL1 antibody was raised using the middle region of MPZL1 corresponding to a region with amino acids ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPZL1 Blocking Peptide, catalog no. 33R-4168, is also available for use as a blocking control in assays to test for specificity of this MPZL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPZL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPZL1

Target: MPZL1 (Myelin Protein Zero-Like 1 (MPZL1))

Alternative Name: MPZL1 (MPZL1 Products)

Synonyms: MPZL1 antibody, MPZL1b antibody, PZR antibody, PZR1b antibody, PZRa antibody, PZRb antibody, 1110007A10Rik antibody, myelin protein zero like 1 antibody, myelin protein zero-like 1 antibody, MPZL1 antibody, Mpzl1 antibody

Background: MPZL1 is a cell surface receptor, which is involved in signal transduction processes. MPZL1 recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2.

Molecular Weight: 23 kDa (MW of target protein)