C-Type Lectin Domain Family 6, Member A (CLEC6A) (N-Term) antibody
-
- Target See all C-Type Lectin Domain Family 6, Member A (CLEC6A) Antibodies
- C-Type Lectin Domain Family 6, Member A (CLEC6A)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CLEC6 A antibody was raised against the N terminal of CLEC6
- Purification
- Affinity purified
- Immunogen
- CLEC6 A antibody was raised using the N terminal of CLEC6 corresponding to a region with amino acids FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK
- Top Product
- Discover our top product CLEC6A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CLEC6A Blocking Peptide, catalog no. 33R-2939, is also available for use as a blocking control in assays to test for specificity of this CLEC6A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLEC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C-Type Lectin Domain Family 6, Member A (CLEC6A)
- Alternative Name
- CLEC6A (CLEC6A Products)
- Synonyms
- CLEC4N antibody, CLECSF10 antibody, CLEC6A antibody, C-type lectin domain containing 6A antibody, C-type lectin domain family 6, member A antibody, CLEC6A antibody, Clec6a antibody
- Background
- CLEC6A may be involved in regulating immune reactivity.
- Molecular Weight
- 24 kDa (MW of target protein)
-