LRRN2 antibody (Middle Region)

Catalog No. ABIN635276

Product Details anti-LRRN2 Antibody

Target: LRRN2 (Leucine Rich Repeat Neuronal 2 (LRRN2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRN2 antibody was raised against the middle region of LRRN2

Purification: Affinity purified

Immunogen: LRRN2 antibody was raised using the middle region of LRRN2 corresponding to a region with amino acids RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRN2 Blocking Peptide, catalog no. 33R-8253, is also available for use as a blocking control in assays to test for specificity of this LRRN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRN2

Target: LRRN2 (Leucine Rich Repeat Neuronal 2 (LRRN2))

Alternative Name: LRRN2 (LRRN2 Products)

Synonyms: GAC1 antibody, LRRN5 antibody, LRANK1 antibody, FIGLER7 antibody, LRRN2 antibody, leucine rich repeat neuronal 2 antibody, LRRN2 antibody, Lrrn2 antibody

Background: The protein encoded by this gene belongs to the leucine-rich repeat superfamily. This gene was found to be amplified and overexpressed in malignant gliomas.

Molecular Weight: 79 kDa (MW of target protein)