ABCB4 antibody
-
- Target See all ABCB4 Antibodies
- ABCB4 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABCB4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ABCB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM
- Top Product
- Discover our top product ABCB4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ABCB4 Blocking Peptide, catalog no. 33R-1187, is also available for use as a blocking control in assays to test for specificity of this ABCB4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCB4 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4))
- Alternative Name
- ABCB4 (ABCB4 Products)
- Synonyms
- ABC21 antibody, GBD1 antibody, ICP3 antibody, MDR2 antibody, MDR2/3 antibody, MDR3 antibody, PFIC-3 antibody, PGY3 antibody, zgc:172149 antibody, Mdr2 antibody, Pgy-2 antibody, Pgy2 antibody, mdr-2 antibody, Pgy3 antibody, ABCB4a antibody, DEFB1 antibody, PGP2 antibody, PGY2 antibody, PGP3 antibody, ABCB4 antibody, RUNDC3B antibody, ATP binding cassette subfamily B member 4 antibody, ATP-binding cassette, sub-family B (MDR/TAP), member 4 antibody, beta-defensin 1-like antibody, ATP-binding cassette, sub-family B (MDR/TAP), member 1B antibody, RUN domain-containing protein 3B antibody, ABCB4 antibody, abcb4 antibody, Abcb4 antibody, LOC100861170 antibody, Abcb1b antibody, LOC101122517 antibody
- Background
- ABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily.
- Molecular Weight
- 141 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-