ABCB4 antibody

Catalog No. ABIN635283

Product Details anti-ABCB4 Antibody

Target: ABCB4 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCB4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ABCB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCB4 Blocking Peptide, catalog no. 33R-1187, is also available for use as a blocking control in assays to test for specificity of this ABCB4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCB4

Target: ABCB4 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 4 (ABCB4))

Alternative Name: ABCB4 (ABCB4 Products)

Synonyms: ABC21 antibody, GBD1 antibody, ICP3 antibody, MDR2 antibody, MDR2/3 antibody, MDR3 antibody, PFIC-3 antibody, PGY3 antibody, zgc:172149 antibody, Mdr2 antibody, Pgy-2 antibody, Pgy2 antibody, mdr-2 antibody, Pgy3 antibody, ABCB4a antibody, DEFB1 antibody, PGP2 antibody, PGY2 antibody, PGP3 antibody, ABCB4 antibody, RUNDC3B antibody, ATP binding cassette subfamily B member 4 antibody, ATP-binding cassette, sub-family B (MDR/TAP), member 4 antibody, beta-defensin 1-like antibody, ATP-binding cassette, sub-family B (MDR/TAP), member 1B antibody, RUN domain-containing protein 3B antibody, ABCB4 antibody, abcb4 antibody, Abcb4 antibody, LOC100861170 antibody, Abcb1b antibody, LOC101122517 antibody

Background: ABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily.

Molecular Weight: 141 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha