CCL17 antibody

Catalog No. ABIN635290

Product Details anti-CCL17 Antibody

Target: CCL17 (Chemokine (C-C Motif) Ligand 17 (CCL17))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCL17 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ABCD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCD2 Blocking Peptide, catalog no. 33R-10001, is also available for use as a blocking control in assays to test for specificity of this ABCD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCL17

Target: CCL17 (Chemokine (C-C Motif) Ligand 17 (CCL17))

Alternative Name: ABCD2 (CCL17 Products)

Synonyms: A-152E5.3 antibody, ABCD-2 antibody, SCYA17 antibody, TARC antibody, CCL17 antibody, Abcd-2 antibody, Scya17 antibody, Scya17l antibody, Tarc antibody, abcd2 antibody, C-C motif chemokine ligand 17 antibody, chemokine (C-C motif) ligand 17 antibody, ATP-binding cassette sub-family D member 2 antibody, CCL17 antibody, Ccl17 antibody, LOC100537809 antibody

Background: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

Molecular Weight: 83 kDa (MW of target protein)