ABCA5 antibody

Catalog No. ABIN635291

Product Details anti-ABCA5 Antibody

Target: ABCA5 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 5 (ABCA5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCA5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ABCA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCA5 Blocking Peptide, catalog no. 33R-3759, is also available for use as a blocking control in assays to test for specificity of this ABCA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCA5

Target: ABCA5 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 5 (ABCA5))

Alternative Name: ABCA5 (ABCA5 Products)

Synonyms: zgc:163009 antibody, ABC13 antibody, EST90625 antibody, B930033A02Rik antibody, mKIAA1888 antibody, ATP binding cassette subfamily A member 5 antibody, ATP-binding cassette, sub-family A (ABC1), member 5 antibody, ATP-binding cassette sub-family A member 5 antibody, ABCA5 antibody, abca5 antibody, LOC100545445 antibody, Abca5 antibody

Background: The membrane-associated protein ABCA5 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). ABCA5 is a member of the ABC1 subfamily.

Molecular Weight: 186 kDa (MW of target protein)