Solute Carrier Family 2 (Facilitated Glucose Transporter) Member 8 (SLC2A8) antibody

Details for Product No. ABIN635294
Antigen
Reactivity
Human
44
36
31
2
Host
Rabbit
41
7
Clonality
Polyclonal
Conjugate
Un-conjugated
4
3
3
3
3
3
3
2
2
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
16
13
13
7
5
2
Options
Immunogen GLUT8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAW
Purification Affinity purified
Antigen
Alternative Name GLUT8 (SLC2A8 Antibody Abstract)
Background SLC2A8 is the insulin-regulated facilitative glucose transporter.SLC2A8 binds cytochalasin B in a glucose-inhibitable manner.SLC2A8 seems to be a dual-specific sugar transporter as it is inhibitable by fructose.
Molecular Weight 51 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

GLUT8 Blocking Peptide, catalog no. 33R-9684, is also available for use as a blocking control in assays to test for specificity of this GLUT8 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Solute Carrier Family 2 (Facilitated Glucose Transporter) Member 8 (SLC2A8) antibody (ABIN635294) GLUT8 antibody used at 1 ug/ml to detect target protein.