CST9 antibody

Catalog No. ABIN635300

Product Details anti-CST9 Antibody

Target: CST9 (Cystatin 9 (Testatin) (CST9))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CST9 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Cystatin 9 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cystatin 9 Blocking Peptide, catalog no. 33R-3925, is also available for use as a blocking control in assays to test for specificity of this Cystatin 9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CST9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CST9

Target: CST9 (Cystatin 9 (Testatin) (CST9))

Alternative Name: Cystatin 9 (CST9 Products)

Synonyms: M12 antibody, cresp antibody, testatin antibody, CLM antibody, CTES7A antibody, cystatin 9 antibody, cystatin-9 antibody, Cst9 antibody, CST9 antibody, LOC781567 antibody

Background: CST9 is part of the cystatin superfamily which encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions.

Molecular Weight: 18 kDa (MW of target protein)