TMTC4 antibody (C-Term)

Catalog No. ABIN635307

Product Details anti-TMTC4 Antibody

Target: TMTC4 (Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMTC4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMTC4 antibody was raised against the C terminal of TMTC4

Purification: Affinity purified

Immunogen: TMTC4 antibody was raised using the C terminal of TMTC4 corresponding to a region with amino acids NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMTC4 Blocking Peptide, catalog no. 33R-6658, is also available for use as a blocking control in assays to test for specificity of this TMTC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMTC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMTC4

Target: TMTC4 (Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4))

Alternative Name: TMTC4 (TMTC4 Products)

Synonyms: si:ch211-168k14.1 antibody, wu:fc58d04 antibody, 4930403J22Rik antibody, 5730419O14Rik antibody, RGD1560183 antibody, transmembrane and tetratricopeptide repeat containing 4 antibody, tmtc4 antibody, TMTC4 antibody, Tmtc4 antibody

Background: TMTC4 belongs to the TMTC family. Its exact function remains unknown.

Molecular Weight: 83 kDa (MW of target protein)