NRSN2 antibody (Middle Region)

Catalog No. ABIN635316

Product Details anti-NRSN2 Antibody

Target: NRSN2 (Neurensin 2 (NRSN2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NRSN2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Neurensin 2 antibody was raised against the middle region of NRSN2

Purification: Affinity purified

Immunogen: Neurensin 2 antibody was raised using the middle region of NRSN2 corresponding to a region with amino acids LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Neurensin 2 Blocking Peptide, catalog no. 33R-5159, is also available for use as a blocking control in assays to test for specificity of this Neurensin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRSN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NRSN2

Target: NRSN2 (Neurensin 2 (NRSN2))

Alternative Name: Neurensin 2 (NRSN2 Products)

Synonyms: C20orf98 antibody, dJ1103G7.6 antibody, Gm123 antibody, Neurensin-2 antibody, neurensin 2 antibody, NRSN2 antibody, Nrsn2 antibody

Background: NRSN2 may play a role in maintenance and/or transport of vesicles.

Molecular Weight: 22 kDa (MW of target protein)