TMEM79 antibody (C-Term)

Catalog No. ABIN635317

Product Details anti-TMEM79 Antibody

Target: TMEM79 (Transmembrane Protein 79 (TMEM79))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM79 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM79 antibody was raised against the C terminal of TMEM79

Purification: Affinity purified

Immunogen: TMEM79 antibody was raised using the C terminal of TMEM79 corresponding to a region with amino acids LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM79 Blocking Peptide, catalog no. 33R-5272, is also available for use as a blocking control in assays to test for specificity of this TMEM79 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM79 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM79

Target: TMEM79 (Transmembrane Protein 79 (TMEM79))

Alternative Name: TMEM79 (TMEM79 Products)

Synonyms: 2310042N02Rik antibody, 2310074C17Rik antibody, RGD1309886 antibody, transmembrane protein 79 antibody, TMEM79 antibody, Tmem79 antibody

Background: TMEM79 is a multi-pass membrane protein. The exact function of TMEM79 remains unknown.

Molecular Weight: 43 kDa (MW of target protein)