TMEM79 antibody (C-Term)
-
- Target See all TMEM79 Antibodies
- TMEM79 (Transmembrane Protein 79 (TMEM79))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM79 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM79 antibody was raised against the C terminal of TMEM79
- Purification
- Affinity purified
- Immunogen
- TMEM79 antibody was raised using the C terminal of TMEM79 corresponding to a region with amino acids LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG
- Top Product
- Discover our top product TMEM79 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM79 Blocking Peptide, catalog no. 33R-5272, is also available for use as a blocking control in assays to test for specificity of this TMEM79 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM79 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM79 (Transmembrane Protein 79 (TMEM79))
- Alternative Name
- TMEM79 (TMEM79 Products)
- Synonyms
- 2310042N02Rik antibody, 2310074C17Rik antibody, RGD1309886 antibody, transmembrane protein 79 antibody, TMEM79 antibody, Tmem79 antibody
- Background
- TMEM79 is a multi-pass membrane protein. The exact function of TMEM79 remains unknown.
- Molecular Weight
- 43 kDa (MW of target protein)
-