SLC7A1 antibody
-
- Target See all SLC7A1 Antibodies
- SLC7A1 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 1 (SLC7A1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC7A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC7 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELWAFITGWNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNA
- Top Product
- Discover our top product SLC7A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC7A1 Blocking Peptide, catalog no. 33R-2581, is also available for use as a blocking control in assays to test for specificity of this SLC7A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC7A1 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 1 (SLC7A1))
- Alternative Name
- SLC7A1 (SLC7A1 Products)
- Synonyms
- ATRC1 antibody, CAT-1 antibody, ERR antibody, HCAT1 antibody, REC1L antibody, CAT1 antibody, CATIONIC AMINO ACID TRANSPORTER 1 antibody, F7J7.60 antibody, F7J7_60 antibody, amino acid transporter 1 antibody, 4831426K01Rik antibody, AI447493 antibody, Atrc-1 antibody, Atrc1 antibody, Cat1 antibody, Rec-1 antibody, Rev-1 antibody, mCAT-1 antibody, Cat-1 antibody, si:ch211-69k21.2 antibody, DKFZp459K194 antibody, solute carrier family 7 member 1 antibody, amino acid transporter 1 antibody, solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 antibody, cationic amino acid transporter Cat1 antibody, SLC7A1 antibody, AAT1 antibody, Slc7a1 antibody, slc7a1 antibody, cat1 antibody
- Background
- SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.
- Molecular Weight
- 68 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-