SPATA9 antibody (N-Term)
-
- Target See all SPATA9 Antibodies
- SPATA9 (Spermatogenesis Associated 9 (SPATA9))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SPATA9 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- SPATA9 antibody was raised against the N terminal of SPATA9
- Purification
- Affinity purified
- Immunogen
- SPATA9 antibody was raised using the N terminal of SPATA9 corresponding to a region with amino acids FKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISR
- Top Product
- Discover our top product SPATA9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SPATA9 Blocking Peptide, catalog no. 33R-2943, is also available for use as a blocking control in assays to test for specificity of this SPATA9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPATA9 (Spermatogenesis Associated 9 (SPATA9))
- Alternative Name
- SPATA9 (SPATA9 Products)
- Synonyms
- SPATA9 antibody, NYD-SP16 antibody, 1700030K01Rik antibody, 4930599C08Rik antibody, A930023H06Rik antibody, spermatogenesis associated 9 antibody, SPATA9 antibody, Spata9 antibody
- Background
- SPATA9 may play a role in testicular development/spermatogenesis and may be an important factor in male infertility. Defects in expression of SPATA9 lead to Sertoli-cell-only syndrome.
- Molecular Weight
- 29 kDa (MW of target protein)
-