SLC5A5 antibody
-
- Target See all SLC5A5 Antibodies
- SLC5A5 (Solute Carrier Family 5 (Sodium/iodide Cotransporter), Member 5 (SLC5A5))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC5A5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC5 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR
- Top Product
- Discover our top product SLC5A5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC5A5 Blocking Peptide, catalog no. 33R-8989, is also available for use as a blocking control in assays to test for specificity of this SLC5A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC5A5 (Solute Carrier Family 5 (Sodium/iodide Cotransporter), Member 5 (SLC5A5))
- Alternative Name
- SLC5A5 (SLC5A5 Products)
- Synonyms
- Na(+)/I(-) cotransporter antibody, Na(+)/I(-) symporter antibody, Nis antibody, solute carrier family 5 member 5 antibody, Slc5a5 antibody
- Background
- The sodium-iodide symporter (NIS, or SLC5A5) is a key plasma membrane protein that mediates active I- uptake in thyroid, lactating breast, and other tissues with an electrogenic stoichiometry of 2 Na+ per I-. In thyroid, NIS-mediated I- uptake is the first step in the biosynthesis of iodine-containing thyroid hormones.
- Molecular Weight
- 69 kDa (MW of target protein)
-